SCOPe 2.08: Domain d2oz4a2: 2oz4 A:186-282

Lineage for d2oz4a2 (2oz4 A:186-282)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2oz4a2: 2oz4 A:186-282 [149100]
   Other proteins in same PDB: d2oz4h_, d2oz4l2
   automated match to d1p53a2
   complexed with nag, so4, trs, zn

Details for d2oz4a2

PDB Entry: 2oz4, 2.7 Å

PDB Description: structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization

PDB Compounds: (A:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d2oz4a2:

Sequence; same for both SEQRES and ATOM records:

>d2oz4a2 b.1.1.0 (A:186-282) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsa
kasvsvtaedegtqrltcavilgnqsqetlqtvtiys

Timeline for d2oz4a2:

• d2oz4a2 first appeared in SCOP 1.75
  
• d2oz4a2 appears in SCOPe 2.07