Lineage for d2oz4a1 (2oz4 A:283-366)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295282Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1295344Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 1295345Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 1295347Domain d2oz4a1: 2oz4 A:283-366 [149099]
    Other proteins in same PDB: d2oz4a2, d2oz4a3, d2oz4h1, d2oz4l1, d2oz4l2
    automatically matched to d1p53a1
    complexed with nag, so4, trs, zn

Details for d2oz4a1

PDB Entry: 2oz4 (more details), 2.7 Å

PDB Description: Structural Plasticity in IgSF Domain 4 of ICAM-1 Mediates Cell Surface Dimerization
PDB Compounds: (A:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d2oz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz4a1 b.1.1.3 (A:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

SCOPe Domain Coordinates for d2oz4a1:

Click to download the PDB-style file with coordinates for d2oz4a1.
(The format of our PDB-style files is described here.)

Timeline for d2oz4a1: