SCOPe 2.03: Domain d2oz4a1: 2oz4 A:283-366

Lineage for d2oz4a1 (2oz4 A:283-366)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d2oz4a1: 2oz4 A:283-366 [149099]
   Other proteins in same PDB: d2oz4a2, d2oz4a3, d2oz4h1, d2oz4l1, d2oz4l2
   automatically matched to d1p53a1
   complexed with nag, so4, trs, zn

Details for d2oz4a1

PDB Entry: 2oz4, 2.7 Å

PDB Description: structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization

PDB Compounds: (A:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d2oz4a1:

Sequence; same for both SEQRES and ATOM records:

>d2oz4a1 b.1.1.3 (A:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

Timeline for d2oz4a1:

• d2oz4a1 first appeared in SCOP 1.75
  
• d2oz4a1 appears in SCOPe 2.02
  
• d2oz4a1 appears in SCOPe 2.04
  
• d2oz4a1 appears in the current release, SCOPe 2.08