Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries) |
Domain d2oz4a1: 2oz4 A:283-366 [149099] Other proteins in same PDB: d2oz4a2, d2oz4a3, d2oz4h1 automatically matched to d1p53a1 complexed with nag, so4, trs, zn |
PDB Entry: 2oz4 (more details), 2.7 Å
SCOPe Domain Sequences for d2oz4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oz4a1 b.1.1.3 (A:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf scsatlevagqlihknqtrelrvl
Timeline for d2oz4a1: