SCOP 1.75: Domain d2oz2a1: 2oz2 A:1-215

Lineage for d2oz2a1 (2oz2 A:1-215)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (15 PDB entries)

8. Domain d2oz2a1: 2oz2 A:1-215 [149097]
   automatically matched to d1ewla_
   complexed with d1r, so4

Details for d2oz2a1

PDB Entry: 2oz2, 1.95 Å

PDB Description: crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (k11777)

PDB Compounds: (A:) Cruzipain

SCOP Domain Sequences for d2oz2a1:

Sequence; same for both SEQRES and ATOM records:

>d2oz2a1 d.3.1.1 (A:1-215) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d2oz2a1:

• d2oz2a1 is new in SCOP 1.75
  
• d2oz2a1 is called d2oz2a_ in SCOPe 2.01
  
• d2oz2a1 appears in the current release, SCOPe 2.08, called d2oz2a_