![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mono-heme c-type cytochrome SoxX [81675] (1 species) |
![]() | Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries) |
![]() | Domain d2oz1h_: 2oz1 H: [149096] Other proteins in same PDB: d2oz1a1, d2oz1a2, d2oz1c1, d2oz1c2, d2oz1e1, d2oz1e2, d2oz1g1, d2oz1g2 automated match to d1h31b_ complexed with hec |
PDB Entry: 2oz1 (more details), 2.35 Å
SCOPe Domain Sequences for d2oz1h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oz1h_ a.3.1.1 (H:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]} aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl mtagqiedvvaylmtltq
Timeline for d2oz1h_: