SCOP 1.75: Domain d2oz1g1: 2oz1 G:1-150

Lineage for d2oz1g1 (2oz1 G:1-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
   two-domain cytochrome c with novel domain arrangement

6. Protein Di-heme cytochrome c SoxA [81678] (1 species)
   cysteine persulfide(cys sulfane) heme coordination

7. Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)

8. Domain d2oz1g1: 2oz1 G:1-150 [149094]
   Other proteins in same PDB: d2oz1b1, d2oz1d1, d2oz1f1, d2oz1h1
   automatically matched to d1h31a1
   complexed with hec

Details for d2oz1g1

PDB Entry: 2oz1, 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum

PDB Compounds: (G:) diheme cytochrome c

SCOP Domain Sequences for d2oz1g1:

Sequence; same for both SEQRES and ATOM records:

>d2oz1g1 a.3.1.8 (G:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

Timeline for d2oz1g1:

• d2oz1g1 is new in SCOP 1.75
  
• d2oz1g1 appears in SCOPe 2.01
  
• d2oz1g1 appears in the current release, SCOPe 2.08