Lineage for d2oz1e2 (2oz1 E:151-261)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 761116Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 761117Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cysteine persulfide(cys sulfane) heme coordination
  7. 761118Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)
  8. 761128Domain d2oz1e2: 2oz1 E:151-261 [149092]
    Other proteins in same PDB: d2oz1b1, d2oz1d1, d2oz1f1, d2oz1h1
    automatically matched to d1h31a2
    complexed with hec

Details for d2oz1e2

PDB Entry: 2oz1 (more details), 2.35 Å

PDB Description: The SoxAX Complex of Rhodovulum Sulfidophilum
PDB Compounds: (E:) diheme cytochrome c

SCOP Domain Sequences for d2oz1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz1e2 a.3.1.8 (E:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna
rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn

SCOP Domain Coordinates for d2oz1e2:

Click to download the PDB-style file with coordinates for d2oz1e2.
(The format of our PDB-style files is described here.)

Timeline for d2oz1e2: