![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein) two-domain cytochrome c with novel domain arrangement |
![]() | Protein Di-heme cytochrome c SoxA [81678] (1 species) cysteine persulfide(cys sulfane) heme coordination |
![]() | Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries) |
![]() | Domain d2oz1e1: 2oz1 E:1-150 [149091] Other proteins in same PDB: d2oz1b_, d2oz1d_, d2oz1f_, d2oz1h_ automated match to d1h32a1 complexed with hec |
PDB Entry: 2oz1 (more details), 2.35 Å
SCOPe Domain Sequences for d2oz1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oz1e1 a.3.1.8 (E:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]} gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg apewdyigpdmtamvaliasvsrgmpvsva
Timeline for d2oz1e1: