Lineage for d2oz0a2 (2oz0 A:2-97)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
    C-terminal domain is beta/alpha barrel
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (6 PDB entries)
  8. Domain d2oz0a2: 2oz0 A:2-97 [149084]
    Other proteins in same PDB: d2oz0a1, d2oz0b_
    automated match to d1kbia2
    complexed with fmn, hem, pyr

Details for d2oz0a2

PDB Entry: 2oz0 (more details), 2.8 Å

PDB Description: Mechanistic and Structural Studies of H373Q Flavocytochrome b2: Effects of Mutating the Active Site Base
PDB Compounds: (A:) Cytochrome b2

SCOPe Domain Sequences for d2oz0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oz0a2 d.120.1.1 (A:2-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtai
feplhapnvidkyiapekklgplqgsmppelvcppy

SCOPe Domain Coordinates for d2oz0a2 are not available.

Timeline for d2oz0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oz0a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2oz0b_