Lineage for d2oz0a1 (2oz0 A:98-510)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080236Protein Flavocytochrome b2, C-terminal domain [51408] (1 species)
  7. 2080237Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51409] (11 PDB entries)
    Uniprot P00175
    N-terminal domain homologous to cytochrome b5
  8. 2080258Domain d2oz0a1: 2oz0 A:98-510 [149083]
    Other proteins in same PDB: d2oz0a2
    automated match to d1kbia1
    complexed with fmn, hem, pyr

Details for d2oz0a1

PDB Entry: 2oz0 (more details), 2.8 Å

PDB Description: Mechanistic and Structural Studies of H373Q Flavocytochrome b2: Effects of Mutating the Active Site Base
PDB Compounds: (A:) Cytochrome b2

SCOPe Domain Sequences for d2oz0a1:

Sequence, based on SEQRES records: (download)

>d2oz0a1 c.1.4.1 (A:98-510) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdiee
lkkktklpivikgvqrtedvikaaeigvsgvvlsnqggrqldfsrapievlaetmpileq
rnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrde
iemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefed

Sequence, based on observed residues (ATOM records): (download)

>d2oz0a1 c.1.4.1 (A:98-510) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apgetkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthren
hnayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcg
qgvtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkal
fvtvdapslgqrekdmklkfsngasralskfidpsltwkdieelkkktklpivikgvqrt
edvikaaeigvsgvvlsnqggrqldfsrapievlaetmpileqrnlkdklevfvdggvrr
gtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelk
pdlldlstlkartvgvpndvlynevyegptltefed

SCOPe Domain Coordinates for d2oz0a1:

Click to download the PDB-style file with coordinates for d2oz0a1.
(The format of our PDB-style files is described here.)

Timeline for d2oz0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oz0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2oz0b_