SCOPe 2.06: Domain d2oyza1: 2oyz A:2-94

Lineage for d2oyza1 (2oyz A:2-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.22: VPA0057-like [159296] (1 protein)
   Pfam PF06865; DUF1255; non-canonical dimerisation mode

6. Protein Uncharacterized protein VPA0057 [159297] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [159298] (1 PDB entry)
   Uniprot Q87K41 2-94

8. Domain d2oyza1: 2oyz A:2-94 [149082]
   Other proteins in same PDB: d2oyza2

Details for d2oyza1

PDB Entry: 2oyz, 1.71 Å

PDB Description: Crystal structure of unknown function protein VPA0057 from Vibrio parahaemolyticus (targeted domain 2-94)

PDB Compounds: (A:) UPF0345 protein VPA0057

SCOPe Domain Sequences for d2oyza1:

Sequence; same for both SEQRES and ATOM records:

>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]}
sikensyfaggvkslgfnqhgqdvsvgvmlpgeytfgtqapermtvvkgalvvkrvgead
wttyssgesfdvegnssfelqvkdataylceyl

Timeline for d2oyza1:

• d2oyza1 first appeared in SCOP 1.75
  
• d2oyza1 appears in SCOPe 2.05
  
• d2oyza1 appears in SCOPe 2.07
  
• d2oyza1 appears in the current release, SCOPe 2.08