Lineage for d2oyza1 (2oyz A:2-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815168Family b.82.1.22: VPA0057-like [159296] (1 protein)
    Pfam PF06865; DUF1255; non-canonical dimerisation mode
  6. 2815169Protein Uncharacterized protein VPA0057 [159297] (1 species)
  7. 2815170Species Vibrio parahaemolyticus [TaxId:670] [159298] (1 PDB entry)
    Uniprot Q87K41 2-94
  8. 2815171Domain d2oyza1: 2oyz A:2-94 [149082]
    Other proteins in same PDB: d2oyza2

Details for d2oyza1

PDB Entry: 2oyz (more details), 1.71 Å

PDB Description: Crystal structure of unknown function protein VPA0057 from Vibrio parahaemolyticus (targeted domain 2-94)
PDB Compounds: (A:) UPF0345 protein VPA0057

SCOPe Domain Sequences for d2oyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]}
sikensyfaggvkslgfnqhgqdvsvgvmlpgeytfgtqapermtvvkgalvvkrvgead
wttyssgesfdvegnssfelqvkdataylceyl

SCOPe Domain Coordinates for d2oyza1:

Click to download the PDB-style file with coordinates for d2oyza1.
(The format of our PDB-style files is described here.)

Timeline for d2oyza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyza2