![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.22: VPA0057-like [159296] (1 protein) Pfam PF06865; DUF1255; non-canonical dimerisation mode |
![]() | Protein Uncharacterized protein VPA0057 [159297] (1 species) |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [159298] (1 PDB entry) Uniprot Q87K41 2-94 |
![]() | Domain d2oyza1: 2oyz A:2-94 [149082] Other proteins in same PDB: d2oyza2 |
PDB Entry: 2oyz (more details), 1.71 Å
SCOPe Domain Sequences for d2oyza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} sikensyfaggvkslgfnqhgqdvsvgvmlpgeytfgtqapermtvvkgalvvkrvgead wttyssgesfdvegnssfelqvkdataylceyl
Timeline for d2oyza1: