Lineage for d2oyup2 (2oyu P:32-73)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062563Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 1062593Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries)
    Uniprot P05979 32-584
  8. 1062608Domain d2oyup2: 2oyu P:32-73 [149081]
    Other proteins in same PDB: d2oyup1
    automatically matched to d1cqeb2
    complexed with bog, hem, ims

Details for d2oyup2

PDB Entry: 2oyu (more details), 2.7 Å

PDB Description: indomethacin-(s)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1
PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d2oyup2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyup2 g.3.11.1 (P:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d2oyup2:

Click to download the PDB-style file with coordinates for d2oyup2.
(The format of our PDB-style files is described here.)

Timeline for d2oyup2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyup1