Lineage for d2oyup1 (2oyu P:74-584)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919711Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 919731Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 919761Species Sheep (Ovis aries) [TaxId:9940] [48137] (20 PDB entries)
    Uniprot P05979 32-584
  8. 919776Domain d2oyup1: 2oyu P:74-584 [149080]
    Other proteins in same PDB: d2oyup2
    automatically matched to d1diya1
    complexed with bog, hem, ims

Details for d2oyup1

PDB Entry: 2oyu (more details), 2.7 Å

PDB Description: indomethacin-(s)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1
PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d2oyup1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyup1 a.93.1.2 (P:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d2oyup1:

Click to download the PDB-style file with coordinates for d2oyup1.
(The format of our PDB-style files is described here.)

Timeline for d2oyup1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyup2