![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins) |
![]() | Protein automated matches [254619] (1 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [255536] (3 PDB entries) |
![]() | Domain d2oyup1: 2oyu P:74-584 [149080] Other proteins in same PDB: d2oyup2 automated match to d1eqha1 complexed with bog, hem, ims |
PDB Entry: 2oyu (more details), 2.7 Å
SCOPe Domain Sequences for d2oyup1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyup1 a.93.1.2 (P:74-584) automated matches {Sheep (Ovis aries) [TaxId: 9940]} iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge vgfnlvktatlkklvclntktcpyvsfhvpd
Timeline for d2oyup1: