Lineage for d2oyup1 (2oyu P:74-584)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. Protein automated matches [254619] (1 species)
    not a true protein
  7. Species Sheep (Ovis aries) [TaxId:9940] [255536] (2 PDB entries)
  8. 2002948Domain d2oyup1: 2oyu P:74-584 [149080]
    Other proteins in same PDB: d2oyup2
    automated match to d1eqha1
    complexed with bog, hem, ims

Details for d2oyup1

PDB Entry: 2oyu (more details), 2.7 Å

PDB Description: indomethacin-(s)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1
PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d2oyup1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyup1 a.93.1.2 (P:74-584) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d2oyup1:

Click to download the PDB-style file with coordinates for d2oyup1.
(The format of our PDB-style files is described here.)

Timeline for d2oyup1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyup2