Lineage for d2oyta_ (2oyt A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586283Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1586284Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1586285Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1586286Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1586329Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)
  8. 1586337Domain d2oyta_: 2oyt A: [149079]
    automated match to d1akza_
    protein/DNA complex

Details for d2oyta_

PDB Entry: 2oyt (more details), 2 Å

PDB Description: crystal structure of ung2/dna(tm)
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2oyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyta_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2oyta_:

Click to download the PDB-style file with coordinates for d2oyta_.
(The format of our PDB-style files is described here.)

Timeline for d2oyta_: