Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.55: YhiQ-like [159686] (1 protein) Pfam PF04445; DUF548; contains extra N-terminal alpha+beta subdomain [beta-alpha-beta(4)] |
Protein Hypothetical protein YhiQ [159687] (3 species) |
Species Shigella flexneri [TaxId:623] [159690] (1 PDB entry) Uniprot Q7UAV7 1-250 |
Domain d2oyra1: 2oyr A:1-250 [149078] complexed with sah |
PDB Entry: 2oyr (more details), 2 Å
SCOPe Domain Sequences for d2oyra1:
Sequence, based on SEQRES records: (download)
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} mkiclidetgagdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqks alvkkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkgh rfdiyagtpv
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} mkiclidetgagdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfv ggamahrrkfgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernp vvaallddglargyadaeiggwlqerlqlihassltaltditprpqvvyldpmfphkqkk emrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkghrfdiy agtpv
Timeline for d2oyra1: