Lineage for d2oyqc2 (2oyq C:376-900)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622168Protein Family B DNA polymerase [56680] (7 species)
  7. 2622169Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 2622291Domain d2oyqc2: 2oyq C:376-900 [149075]
    Other proteins in same PDB: d2oyqa1, d2oyqb1, d2oyqc1, d2oyqd1
    automated match to d1ig9a2
    protein/DNA complex; complexed with mg, n5p

Details for d2oyqc2

PDB Entry: 2oyq (more details), 2.86 Å

PDB Description: crystal structure of rb69 gp43 in complex with dna with 5-nimp opposite an abasic site analog
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d2oyqc2:

Sequence, based on SEQRES records: (download)

>d2oyqc2 e.8.1.1 (C:376-900) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm

Sequence, based on observed residues (ATOM records): (download)

>d2oyqc2 e.8.1.1 (C:376-900) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhepldvdyrfddeikekikklsakslnemlfraqrtevagmtaqinrkllin
slygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegeafvlygdtds
iyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymnnkqhlmfmd
reaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqksstpkavqka
lkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvggfpgpkcpfh
irgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteitdlikddvlh
wmdytvllektfikplegftsaakldyekkaslfdm

SCOPe Domain Coordinates for d2oyqc2:

Click to download the PDB-style file with coordinates for d2oyqc2.
(The format of our PDB-style files is described here.)

Timeline for d2oyqc2: