Lineage for d2oyqc1 (2oyq C:1-375)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172062Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1172413Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1172414Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 1172415Species Bacteriophage RB69 [TaxId:12353] [53127] (15 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 1172438Domain d2oyqc1: 2oyq C:1-375 [149074]
    Other proteins in same PDB: d2oyqa2, d2oyqb2, d2oyqc2, d2oyqd2
    automatically matched to d1clqa1
    protein/DNA complex; complexed with mg, n5p

Details for d2oyqc1

PDB Entry: 2oyq (more details), 2.86 Å

PDB Description: crystal structure of rb69 gp43 in complex with dna with 5-nimp opposite an abasic site analog
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d2oyqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyqc1 c.55.3.5 (C:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOPe Domain Coordinates for d2oyqc1:

Click to download the PDB-style file with coordinates for d2oyqc1.
(The format of our PDB-style files is described here.)

Timeline for d2oyqc1: