SCOPe 2.08: Domain d2oyob_: 2oyo B:

Lineage for d2oyob_ (2oyo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.3: Atu0492-like [140970] (6 proteins)
   duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family

6. Protein Uncharacterized protein Dgeo_1446 [158821] (1 species)

7. Species Deinococcus geothermalis [TaxId:68909] [158822] (1 PDB entry)
   Uniprot Q1IYE3 10-195

8. Domain d2oyob_: 2oyo B: [149069]
   automated match to d2oyoa1
   complexed with mpd

Details for d2oyob_

PDB Entry: 2oyo, 1.51 Å

PDB Description: crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution

PDB Compounds: (B:) Uncharacterized peroxidase-related protein

SCOPe Domain Sequences for d2oyob_:

Sequence; same for both SEQRES and ATOM records:

>d2oyob_ a.152.1.3 (B:) Uncharacterized protein Dgeo_1446 {Deinococcus geothermalis [TaxId: 68909]}
drisslpvpdatqvpegvrklwakaeanigfvpnvfraqavngeqflawwnyfnlllnke
gyltnaerelvavvvsgvnrclycavshgaalreflgdpqkadavavnwrhadltereqa
laayaekltrhpaevtaadleplravglddhqimelvqvigmfnltnrvssalgfvpnpe
yyrqar

Timeline for d2oyob_:

• d2oyob_ first appeared in SCOP 1.75, called d2oyob1
  
• d2oyob_ appears in SCOPe 2.07