Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries) Uniprot P05979 32-584 |
Domain d2oyep2: 2oye P:32-73 [149066] Other proteins in same PDB: d2oyep1 automatically matched to d1cqeb2 complexed with bma, bog, flc, hem, im8, nag, ndg |
PDB Entry: 2oye (more details), 2.85 Å
SCOP Domain Sequences for d2oyep2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyep2 g.3.11.1 (P:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d2oyep2: