Lineage for d2oyep2 (2oye P:32-73)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583282Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2583283Protein automated matches [226968] (4 species)
    not a true protein
  7. Species Sheep (Ovis aries) [TaxId:9940] [255535] (2 PDB entries)
  8. 2583355Domain d2oyep2: 2oye P:32-73 [149066]
    Other proteins in same PDB: d2oyep1
    automated match to d1q4ga2
    complexed with bma, bog, flc, hem, im8, nag, ndg

Details for d2oyep2

PDB Entry: 2oye (more details), 2.85 Å

PDB Description: indomethacin-(r)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1
PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d2oyep2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyep2 g.3.11.0 (P:32-73) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d2oyep2:

Click to download the PDB-style file with coordinates for d2oyep2.
(The format of our PDB-style files is described here.)

Timeline for d2oyep2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyep1