SCOPe 2.08: Domain d2oyep2: 2oye P:32-73

Lineage for d2oyep2 (2oye P:32-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [255535] (3 PDB entries)

8. Domain d2oyep2: 2oye P:32-73 [149066]
   Other proteins in same PDB: d2oyep1
   automated match to d1q4ga2
   complexed with bog, flc, hem, im8

Details for d2oyep2

PDB Entry: 2oye, 2.85 Å

PDB Description: indomethacin-(r)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1

PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d2oyep2:

Sequence; same for both SEQRES and ATOM records:

>d2oyep2 g.3.11.0 (P:32-73) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d2oyep2:

• d2oyep2 first appeared in SCOP 1.75
  
• d2oyep2 appears in SCOPe 2.07