Lineage for d2oyep1 (2oye P:74-584)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773495Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 773515Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 773545Species Sheep (Ovis aries) [TaxId:9940] [48137] (20 PDB entries)
    Uniprot P05979 32-584
  8. 773569Domain d2oyep1: 2oye P:74-584 [149065]
    Other proteins in same PDB: d2oyep2
    automatically matched to d1diya1
    complexed with bma, bog, flc, hem, im8, nag, ndg

Details for d2oyep1

PDB Entry: 2oye (more details), 2.85 Å

PDB Description: indomethacin-(r)-alpha-ethyl-ethanolamide bound to cyclooxygenase-1
PDB Compounds: (P:) Prostaglandin G/H synthase 1

SCOP Domain Sequences for d2oyep1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyep1 a.93.1.2 (P:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOP Domain Coordinates for d2oyep1:

Click to download the PDB-style file with coordinates for d2oyep1.
(The format of our PDB-style files is described here.)

Timeline for d2oyep1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyep2