Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins) |
Protein automated matches [254619] (1 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [255536] (3 PDB entries) |
Domain d2oyep1: 2oye P:74-584 [149065] Other proteins in same PDB: d2oyep2 automated match to d1eqha1 complexed with bog, flc, hem, im8 |
PDB Entry: 2oye (more details), 2.85 Å
SCOPe Domain Sequences for d2oyep1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyep1 a.93.1.2 (P:74-584) automated matches {Sheep (Ovis aries) [TaxId: 9940]} iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge vgfnlvktatlkklvclntktcpyvsfhvpd
Timeline for d2oyep1: