![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.276: BH2638-like [158503] (1 superfamily) 4 helices, folded leaf, right-handed superhelix; some similarity to the DFF-C domain fold (81782) |
![]() | Superfamily a.276.1: BH2638-like [158504] (1 family) ![]() automatically mapped to Pfam PF05256 |
![]() | Family a.276.1.1: BH2638-like [158505] (1 protein) Pfam PF05256; UPF0223 |
![]() | Protein Uncharacterized protein BH2638 [158506] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [158507] (1 PDB entry) Uniprot Q9K9K7 4-88 |
![]() | Domain d2oy9b_: 2oy9 B: [149064] automated match to d2oy9a1 complexed with mg |
PDB Entry: 2oy9 (more details), 1.6 Å
SCOPe Domain Sequences for d2oy9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oy9b_ a.276.1.1 (B:) Uncharacterized protein BH2638 {Bacillus halodurans [TaxId: 86665]} isldwsteevidvvhffqaieqaydqgiaredllgkyrrfkeivpskseekqlfrayeqe ndvscyqtikkareemeehiqm
Timeline for d2oy9b_: