SCOPe 2.06: Domain d2oy9a1: 2oy9 A:6-90

Lineage for d2oy9a1 (2oy9 A:6-90)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.276: BH2638-like [158503] (1 superfamily)
   4 helices, folded leaf, right-handed superhelix; some similarity to the DFF-C domain fold (81782)

4. Superfamily a.276.1: BH2638-like [158504] (1 family)
   automatically mapped to Pfam PF05256

5. Family a.276.1.1: BH2638-like [158505] (1 protein)
   Pfam PF05256; UPF0223

6. Protein Uncharacterized protein BH2638 [158506] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [158507] (1 PDB entry)
   Uniprot Q9K9K7 4-88

8. Domain d2oy9a1: 2oy9 A:6-90 [149063]
   complexed with mg

Details for d2oy9a1

PDB Entry: 2oy9, 1.6 Å

PDB Description: crystal structure of an unknown conserved protein- pfam: upf0223

PDB Compounds: (A:) UPF0223 protein BH2638

SCOPe Domain Sequences for d2oy9a1:

Sequence; same for both SEQRES and ATOM records:

>d2oy9a1 a.276.1.1 (A:6-90) Uncharacterized protein BH2638 {Bacillus halodurans [TaxId: 86665]}
tlpisldwsteevidvvhffqaieqaydqgiaredllgkyrrfkeivpskseekqlfray
eqendvscyqtikkareemeehiqm

Timeline for d2oy9a1:

• d2oy9a1 first appeared in SCOP 1.75
  
• d2oy9a1 appears in SCOPe 2.05
  
• d2oy9a1 appears in SCOPe 2.07
  
• d2oy9a1 appears in the current release, SCOPe 2.08