Lineage for d2oxyb1 (2oxy B:7-331)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875082Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 875089Species Maize (Zea mays) [TaxId:4577] [56143] (20 PDB entries)
  8. 875095Domain d2oxyb1: 2oxy B:7-331 [149062]
    automatically matched to d1f0qa_
    complexed with k17

Details for d2oxyb1

PDB Entry: 2oxy (more details), 1.81 Å

PDB Description: Protein kinase CK2 in complex with tetrabromobenzoimidazole derivatives K17, K22 and K32
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOP Domain Sequences for d2oxyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxyb1 d.144.1.7 (B:7-331) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraae

SCOP Domain Coordinates for d2oxyb1:

Click to download the PDB-style file with coordinates for d2oxyb1.
(The format of our PDB-style files is described here.)

Timeline for d2oxyb1: