Lineage for d2ox6a1 (2ox6 A:5-166)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768250Family a.35.1.6: YdiL-like [109813] (2 proteins)
    contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA
  6. 768251Protein Hypothetical protein SO3848 [158467] (1 species)
  7. 768252Species Shewanella oneidensis [TaxId:70863] [158468] (1 PDB entry)
    Uniprot Q8EAP9 5-166
  8. 768253Domain d2ox6a1: 2ox6 A:5-166 [149053]
    complexed with mg

Details for d2ox6a1

PDB Entry: 2ox6 (more details), 1.7 Å

PDB Description: Crystal structure of gene product SO3848 from Shewanella oneidensis MR-1
PDB Compounds: (A:) Hypothetical protein SO3848

SCOP Domain Sequences for d2ox6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox6a1 a.35.1.6 (A:5-166) Hypothetical protein SO3848 {Shewanella oneidensis [TaxId: 70863]}
iglnaiemsylrqslslsaaqvgqltnhseaevlawenaetqapelaqkklldiddiiem
qvlnttdgiealfkkepkrhlafvvyptqaiytqynpeflsslpltelyntaawrikkec
klvlevdvslinlnveaykayreqnglsesresrakwaatql

SCOP Domain Coordinates for d2ox6a1:

Click to download the PDB-style file with coordinates for d2ox6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ox6a1: