Lineage for d2owta_ (2owt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145194Species Bordetella pertussis [TaxId:257313] [187275] (2 PDB entries)
  8. 2145196Domain d2owta_: 2owt A: [149052]
    automated match to d1y9ua_
    complexed with co3, fe

Details for d2owta_

PDB Entry: 2owt (more details), 2.4 Å

PDB Description: Crystal structure of Bordetella pertussis holo ferric binding protein with bound synergistic carbonate anion
PDB Compounds: (A:) Putative iron binding protein

SCOPe Domain Sequences for d2owta_:

Sequence, based on SEQRES records: (download)

>d2owta_ c.94.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 257313]}
sdevslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlmtvdi
gnlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsfrygd
ladpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdrdvar
dilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfatakdggthvnisgaav
aahapnkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtlpvae
iakyrkqaselvdkvgfdn

Sequence, based on observed residues (ATOM records): (download)

>d2owta_ c.94.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 257313]}
sdevslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlmtvdi
gnlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsfrygd
ladpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdrdvar
dilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfaggthvnisgaavaaha
pnkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtlpvaeiaky
rkqaselvdkvgfdn

SCOPe Domain Coordinates for d2owta_:

Click to download the PDB-style file with coordinates for d2owta_.
(The format of our PDB-style files is described here.)

Timeline for d2owta_: