Lineage for d2owpb1 (2owp B:1-128)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 856048Family d.17.4.18: BxeB1374-like [159999] (2 proteins)
    similar dimer to KSI
  6. 856049Protein Hypothetical protein BxeB1374 [160002] (1 species)
  7. 856050Species Burkholderia xenovorans [TaxId:36873] [160003] (1 PDB entry)
    Uniprot Q13MU9 1-128
  8. 856052Domain d2owpb1: 2owp B:1-128 [149050]
    automatically matched to 2OWP A:1-128
    complexed with edo, so4

Details for d2owpb1

PDB Entry: 2owp (more details), 2 Å

PDB Description: crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 a resolution
PDB Compounds: (B:) Hypothetical protein Bxe_B1374

SCOP Domain Sequences for d2owpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2owpb1 d.17.4.18 (B:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}
mevnqpdivaqvqaafveyeralvendieamnalfwhtpetvrygiaevqhggeairawr
ercepvpksrklhrtvvttfgtdfatvsteftsdatpllgrqmqtwarlspadgwkivaa
hvsliamp

SCOP Domain Coordinates for d2owpb1:

Click to download the PDB-style file with coordinates for d2owpb1.
(The format of our PDB-style files is described here.)

Timeline for d2owpb1: