SCOPe 2.08: Domain d2owpb2: 2owp B:1-128

Lineage for d2owpb2 (2owp B:1-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.18: BxeB1374-like [159999] (2 proteins)
   similar dimer to KSI
   automatically mapped to Pfam PF11533

6. Protein Hypothetical protein BxeB1374 [160002] (1 species)

7. Species Burkholderia xenovorans [TaxId:36873] [160003] (1 PDB entry)
   Uniprot Q13MU9 1-128

8. Domain d2owpb2: 2owp B:1-128 [149050]
   Other proteins in same PDB: d2owpa2, d2owpb3
   automated match to d2owpa1
   complexed with edo, so4

Details for d2owpb2

PDB Entry: 2owp, 2 Å

PDB Description: crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 a resolution

PDB Compounds: (B:) Hypothetical protein Bxe_B1374

SCOPe Domain Sequences for d2owpb2:

Sequence; same for both SEQRES and ATOM records:

>d2owpb2 d.17.4.18 (B:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}
mevnqpdivaqvqaafveyeralvendieamnalfwhtpetvrygiaevqhggeairawr
ercepvpksrklhrtvvttfgtdfatvsteftsdatpllgrqmqtwarlspadgwkivaa
hvsliamp

Timeline for d2owpb2:

• d2owpb2 first appeared in SCOP 1.75, called d2owpb1
  
• d2owpb2 appears in SCOPe 2.07