SCOPe 2.08: Domain d2ownb2: 2own B:150-261

Lineage for d2ownb2 (2own B:150-261)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.8: Acyl-ACP thioesterase-like [143190] (2 proteins)
   Pfam PF01643; duplication: consists of two 4HBT-like domains

6. Protein Putative oleoyl-ACP thioesterase LP0708 [160188] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [160189] (1 PDB entry)
   Uniprot Q88YP1 150-258! Uniprot Q88YP1 3-149

8. Domain d2ownb2: 2own B:150-261 [149048]
   automated match to d2owna2
   complexed with act, gol, so4, unl

Details for d2ownb2

PDB Entry: 2own, 2 Å

PDB Description: crystal structure of oleoyl thioesterase (putative) (np_784467.1) from lactobacillus plantarum at 2.00 a resolution

PDB Compounds: (B:) Putative Oleoyl-[acyl-carrier protein] thioesterase

SCOPe Domain Sequences for d2ownb2:

Sequence; same for both SEQRES and ATOM records:

>d2ownb2 d.38.1.8 (B:150-261) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}
rpisfeatdttitkpyhvrffdidpnrhvnnahyfdwlvdtlpatfllqhdlvhvdvrye
nevkygqtvtahanilpsevadqvttshlievddekccevtiqwrtlpepiq

Timeline for d2ownb2:

• d2ownb2 first appeared in SCOP 1.75
  
• d2ownb2 appears in SCOPe 2.07