Lineage for d2ownb2 (2own B:150-261)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944296Family d.38.1.8: Acyl-ACP thioesterase-like [143190] (2 proteins)
    Pfam PF01643; duplication: consists of two 4HBT-like domains
  6. 2944301Protein Putative oleoyl-ACP thioesterase LP0708 [160188] (1 species)
  7. 2944302Species Lactobacillus plantarum [TaxId:1590] [160189] (1 PDB entry)
    Uniprot Q88YP1 150-258! Uniprot Q88YP1 3-149
  8. 2944306Domain d2ownb2: 2own B:150-261 [149048]
    automated match to d2owna2
    complexed with act, gol, so4, unl

Details for d2ownb2

PDB Entry: 2own (more details), 2 Å

PDB Description: crystal structure of oleoyl thioesterase (putative) (np_784467.1) from lactobacillus plantarum at 2.00 a resolution
PDB Compounds: (B:) Putative Oleoyl-[acyl-carrier protein] thioesterase

SCOPe Domain Sequences for d2ownb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ownb2 d.38.1.8 (B:150-261) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}
rpisfeatdttitkpyhvrffdidpnrhvnnahyfdwlvdtlpatfllqhdlvhvdvrye
nevkygqtvtahanilpsevadqvttshlievddekccevtiqwrtlpepiq

SCOPe Domain Coordinates for d2ownb2:

Click to download the PDB-style file with coordinates for d2ownb2.
(The format of our PDB-style files is described here.)

Timeline for d2ownb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ownb1