Lineage for d2ownb1 (2own B:3-149)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188459Family d.38.1.8: Acyl-ACP thioesterase-like [143190] (2 proteins)
    Pfam PF01643; duplication: consists of two 4HBT-like domains
  6. 2188464Protein Putative oleoyl-ACP thioesterase LP0708 [160188] (1 species)
  7. 2188465Species Lactobacillus plantarum [TaxId:1590] [160189] (1 PDB entry)
    Uniprot Q88YP1 150-258! Uniprot Q88YP1 3-149
  8. 2188468Domain d2ownb1: 2own B:3-149 [149047]
    automated match to d2owna1
    complexed with act, gol, so4, unl

Details for d2ownb1

PDB Entry: 2own (more details), 2 Å

PDB Description: crystal structure of oleoyl thioesterase (putative) (np_784467.1) from lactobacillus plantarum at 2.00 a resolution
PDB Compounds: (B:) Putative Oleoyl-[acyl-carrier protein] thioesterase

SCOPe Domain Sequences for d2ownb1:

Sequence, based on SEQRES records: (download)

>d2ownb1 d.38.1.8 (B:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}
tlganaslyseqhrityyecdrtgratlttlidiavlasedqsdalglttemvqshgvgw
vvtqyaiditrmprqdevvtiavrgsaynpyfayrefwirdadgqqlayitsiwvmmsqt
trrivkilpelvapyqsevvkriprlp

Sequence, based on observed residues (ATOM records): (download)

>d2ownb1 d.38.1.8 (B:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}
tlganaslyseqhrityyecdrtgratlttlidiavlasedqsdalglttemvqshgvgw
vvtqyaiditrmprqdevvtiavrgsaynpyfayrefwirdadgqqlayitsiwvmmsqt
trrivkilpelvapyqsevvriprlp

SCOPe Domain Coordinates for d2ownb1:

Click to download the PDB-style file with coordinates for d2ownb1.
(The format of our PDB-style files is described here.)

Timeline for d2ownb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ownb2