Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.8: Acyl-ACP thioesterase-like [143190] (2 proteins) Pfam PF01643; duplication: consists of two 4HBT-like domains |
Protein Putative oleoyl-ACP thioesterase LP0708 [160188] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [160189] (1 PDB entry) Uniprot Q88YP1 150-258! Uniprot Q88YP1 3-149 |
Domain d2owna2: 2own A:150-258 [149046] complexed with act, gol, so4, unl |
PDB Entry: 2own (more details), 2 Å
SCOPe Domain Sequences for d2owna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} rpisfeatdttitkpyhvrffdidpnrhvnnahyfdwlvdtlpatfllqhdlvhvdvrye nevkygqtvtahanilpsevadqvttshlievddekccevtiqwrtlpe
Timeline for d2owna2: