SCOPe 2.03: Domain d2ov9c_: 2ov9 C:

Lineage for d2ov9c_ (2ov9 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein RHA1_ro05818 [160184] (1 species)
   includes two extra N-terminal helices forming an interlocking four-helical bundle in the dimer

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [160185] (1 PDB entry)
   Uniprot Q0S4E1 7-209

8. Domain d2ov9c_: 2ov9 C: [149036]
   automated match to d2ov9a1
   complexed with so4

Details for d2ov9c_

PDB Entry: 2ov9, 1.9 Å

PDB Description: Crystal structure of protein RHA08564, thioesterase superfamily protein

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2ov9c_:

Sequence; same for both SEQRES and ATOM records:

>d2ov9c_ d.38.1.5 (C:) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}
hptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghl
eehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgp
pghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrk
ittagdirtadgqvcvsveglfvdkt

Timeline for d2ov9c_:

• d2ov9c_ first appeared in SCOP 1.75, called d2ov9c1
  
• d2ov9c_ appears in SCOPe 2.02
  
• d2ov9c_ appears in SCOPe 2.04
  
• d2ov9c_ appears in the current release, SCOPe 2.08