SCOP 1.75: Domain d2ov9c1: 2ov9 C:7-209

Lineage for d2ov9c1 (2ov9 C:7-209)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)

6. Protein Hypothetical protein RHA1_ro05818 [160184] (1 species)
   includes two extra N-terminal helices forming an interlocking four-helical bundle in the dimer

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [160185] (1 PDB entry)
   Uniprot Q0S4E1 7-209

8. Domain d2ov9c1: 2ov9 C:7-209 [149036]
   automatically matched to 2OV9 A:7-209
   complexed with so4

Details for d2ov9c1

PDB Entry: 2ov9, 1.9 Å

PDB Description: Crystal structure of protein RHA08564, thioesterase superfamily protein

PDB Compounds: (C:) hypothetical protein

SCOP Domain Sequences for d2ov9c1:

Sequence; same for both SEQRES and ATOM records:

>d2ov9c1 d.38.1.5 (C:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}
ptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghle
ehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgpp
ghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrki
ttagdirtadgqvcvsveglfvd

Timeline for d2ov9c1:

• d2ov9c1 is new in SCOP 1.75
  
• d2ov9c1 is called d2ov9c_ in SCOPe 2.01
  
• d2ov9c1 appears in the current release, SCOPe 2.08, called d2ov9c_