Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins) |
Protein Hypothetical protein RHA1_ro05818 [160184] (1 species) includes two extra N-terminal helices forming an interlocking four-helical bundle in the dimer |
Species Rhodococcus sp. RHA1 [TaxId:101510] [160185] (1 PDB entry) Uniprot Q0S4E1 7-209 |
Domain d2ov9c1: 2ov9 C:7-209 [149036] automatically matched to 2OV9 A:7-209 complexed with so4 |
PDB Entry: 2ov9 (more details), 1.9 Å
SCOP Domain Sequences for d2ov9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ov9c1 d.38.1.5 (C:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} ptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghle ehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgpp ghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrki ttagdirtadgqvcvsveglfvd
Timeline for d2ov9c1: