![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein RHA1_ro05818 [160184] (1 species) includes two extra N-terminal helices forming an interlocking four-helical bundle in the dimer |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [160185] (1 PDB entry) Uniprot Q0S4E1 7-209 |
![]() | Domain d2ov9a1: 2ov9 A:7-209 [149034] complexed with so4 |
PDB Entry: 2ov9 (more details), 1.9 Å
SCOPe Domain Sequences for d2ov9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} ptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghle ehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgpp ghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrki ttagdirtadgqvcvsveglfvd
Timeline for d2ov9a1: