SCOPe 2.08: Domain d2ouwb2: 2ouw B:1-135

Lineage for d2ouwb2 (2ouw B:1-135)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.4: TTHA0727-like [140975] (2 proteins)
   similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains

6. Protein Hypothetical protein Rru_A0301 [158827] (1 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [158828] (1 PDB entry)
   Uniprot Q2RXN9 1-134

8. Domain d2ouwb2: 2ouw B:1-135 [149030]
   Other proteins in same PDB: d2ouwa2, d2ouwb3
   automated match to d2ouwa1
   complexed with acy, na, unl

Details for d2ouwb2

PDB Entry: 2ouw, 1.95 Å

PDB Description: crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution

PDB Compounds: (B:) Alkylhydroperoxidase AhpD core

SCOPe Domain Sequences for d2ouwb2:

Sequence; same for both SEQRES and ATOM records:

>d2ouwb2 a.152.1.4 (B:1-135) Hypothetical protein Rru_A0301 {Rhodospirillum rubrum [TaxId: 1085]}
matvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvmv
gegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtnal
vtamqipvdeaflvd

Timeline for d2ouwb2:

• d2ouwb2 first appeared in SCOP 1.75, called d2ouwb1
  
• d2ouwb2 appears in SCOPe 2.07