| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
| Family a.152.1.4: TTHA0727-like [140975] (2 proteins) similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains |
| Protein Hypothetical protein Rru_A0301 [158827] (1 species) |
| Species Rhodospirillum rubrum [TaxId:1085] [158828] (1 PDB entry) Uniprot Q2RXN9 1-134 |
| Domain d2ouwa1: 2ouw A:1-134 [149029] Other proteins in same PDB: d2ouwa2, d2ouwb3 complexed with acy, na, unl |
PDB Entry: 2ouw (more details), 1.95 Å
SCOPe Domain Sequences for d2ouwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ouwa1 a.152.1.4 (A:1-134) Hypothetical protein Rru_A0301 {Rhodospirillum rubrum [TaxId: 1085]}
matvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvmv
gegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtnal
vtamqipvdeaflv
Timeline for d2ouwa1: