Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.1: YqbF N-terminal domain-like [160060] (2 proteins) |
Protein Mu-like prophage FluMu protein gp35, HI1506 [160063] (1 species) |
Species Haemophilus influenzae [TaxId:727] [160064] (1 PDB entry) Uniprot P44228 1-67 |
Domain d2outa2: 2out A:4-70 [149028] Other proteins in same PDB: d2outa1, d2outa3 |
PDB Entry: 2out (more details)
SCOPe Domain Sequences for d2outa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2outa2 d.344.1.1 (A:4-70) Mu-like prophage FluMu protein gp35, HI1506 {Haemophilus influenzae [TaxId: 727]} mdktfcvvvqnrikegyrragfsfhlgdnslaavsesqlaqlkadprlvvqitetgsqeg geglske
Timeline for d2outa2: