![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.26: ICP-like [141066] (2 families) ![]() topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region |
![]() | Family b.1.26.1: ICP-like [141067] (2 proteins) PfamB PB014070 |
![]() | Protein Chagasin [141068] (1 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries) Uniprot Q966X9 3-110 |
![]() | Domain d2oulb_: 2oul B: [149026] Other proteins in same PDB: d2oula_ automated match to d2fo8a1 |
PDB Entry: 2oul (more details), 2.2 Å
SCOPe Domain Sequences for d2oulb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oulb_ b.1.26.1 (B:) Chagasin {Trypanosoma cruzi [TaxId: 5693]} kvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppdsk llgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
Timeline for d2oulb_: