Lineage for d2oulb1 (2oul B:4-110)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 789767Superfamily b.1.26: ICP-like [141066] (1 family) (S)
    topological variant with similarity to the Cupredoxin-like fold ((49502)) in the N-terminal region
  5. 789768Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
  6. 789769Protein Chagasin [141068] (1 species)
  7. 789770Species Trypanosoma cruzi [TaxId:5693] [141069] (7 PDB entries)
    Uniprot Q966X9 3-110
  8. 789777Domain d2oulb1: 2oul B:4-110 [149026]
    Other proteins in same PDB: d2oula1
    automatically matched to d2fo8a1

Details for d2oulb1

PDB Entry: 2oul (more details), 2.2 Å

PDB Description: the structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
PDB Compounds: (B:) Chagasin

SCOP Domain Sequences for d2oulb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oulb1 b.1.26.1 (B:4-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
kvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppdsk
llgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

SCOP Domain Coordinates for d2oulb1:

Click to download the PDB-style file with coordinates for d2oulb1.
(The format of our PDB-style files is described here.)

Timeline for d2oulb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oula1