SCOP 1.75: Domain d2oulb1: 2oul B:4-110

Lineage for d2oulb1 (2oul B:4-110)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.26: ICP-like [141066] (1 family)
   topological variant with similarity to the Cupredoxin-like fold ((49502)) in the N-terminal region

5. Family b.1.26.1: ICP-like [141067] (2 proteins)
   PfamB PB014070

6. Protein Chagasin [141068] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [141069] (7 PDB entries)
   Uniprot Q966X9 3-110

8. Domain d2oulb1: 2oul B:4-110 [149026]
   Other proteins in same PDB: d2oula1
   automatically matched to d2fo8a1

Details for d2oulb1

PDB Entry: 2oul, 2.2 Å

PDB Description: the structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family

PDB Compounds: (B:) Chagasin

SCOP Domain Sequences for d2oulb1:

Sequence; same for both SEQRES and ATOM records:

>d2oulb1 b.1.26.1 (B:4-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
kvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppdsk
llgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

Timeline for d2oulb1:

• d2oulb1 is new in SCOP 1.75
  
• d2oulb1 is called d2oulb_ in SCOPe 2.01
  
• d2oulb1 appears in the current release, SCOPe 2.08, called d2oulb_