Lineage for d2oula_ (2oul A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1014846Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1015065Protein Falcipain 2 [142846] (1 species)
  7. 1015066Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (4 PDB entries)
    Uniprot Q9N6S8 244-484
  8. 1015067Domain d2oula_: 2oul A: [149025]
    Other proteins in same PDB: d2oulb_
    automated match to d1yvba1

Details for d2oula_

PDB Entry: 2oul (more details), 2.2 Å

PDB Description: the structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
PDB Compounds: (A:) falcipain 2

SCOPe Domain Sequences for d2oula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oula_ d.3.1.1 (A:) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

SCOPe Domain Coordinates for d2oula_:

Click to download the PDB-style file with coordinates for d2oula_.
(The format of our PDB-style files is described here.)

Timeline for d2oula_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oulb_