Lineage for d2ouja1 (2ouj A:12-214)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794771Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 794836Protein Thrombospondin 1 N-terminal domain [141150] (1 species)
  7. 794837Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
    Uniprot P07996 28-233! Uniprot P07996 29-233
  8. 794843Domain d2ouja1: 2ouj A:12-214 [149024]
    automatically matched to d1z78a1

Details for d2ouja1

PDB Entry: 2ouj (more details), 1.9 Å

PDB Description: The crystal structure of the Thrombospondin-1 N-terminal domain in complex with fractionated Heparin DP8
PDB Compounds: (A:) Thrombospondin-1

SCOP Domain Sequences for d2ouja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouja1 b.29.1.4 (A:12-214) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgfl
llaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveealla
tgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnfq
gvlqnvrfvfgttpedilrnkgc

SCOP Domain Coordinates for d2ouja1:

Click to download the PDB-style file with coordinates for d2ouja1.
(The format of our PDB-style files is described here.)

Timeline for d2ouja1: