SCOPe 2.06: Domain d2ouhb_: 2ouh B:

Lineage for d2ouhb_ (2ouh B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Thrombospondin 1 N-terminal domain [141150] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
   Uniprot P07996 28-233! Uniprot P07996 29-233

8. Domain d2ouhb_: 2ouh B: [149023]
   automated match to d1za4a1
   complexed with so4

Details for d2ouhb_

PDB Entry: 2ouh, 2.4 Å

PDB Description: Crystal structure of the Thrombospondin-1 N-terminal domain in complex with fractionated Heparin DP10

PDB Compounds: (B:) Thrombospondin-1

SCOPe Domain Sequences for d2ouhb_:

Sequence; same for both SEQRES and ATOM records:

>d2ouhb_ b.29.1.4 (B:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgfl
llaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveealla
tgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnfq
gvlqnvrfvfgttpedilrnkgc

Timeline for d2ouhb_:

• d2ouhb_ first appeared in SCOP 1.75, called d2ouhb1
  
• d2ouhb_ appears in SCOPe 2.05
  
• d2ouhb_ appears in SCOPe 2.07
  
• d2ouhb_ appears in the current release, SCOPe 2.08