Lineage for d2ouhb_ (2ouh B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780927Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1780999Protein Thrombospondin 1 N-terminal domain [141150] (1 species)
  7. 1781000Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
    Uniprot P07996 28-233! Uniprot P07996 29-233
  8. 1781008Domain d2ouhb_: 2ouh B: [149023]
    automated match to d1za4a1
    complexed with so4

Details for d2ouhb_

PDB Entry: 2ouh (more details), 2.4 Å

PDB Description: Crystal structure of the Thrombospondin-1 N-terminal domain in complex with fractionated Heparin DP10
PDB Compounds: (B:) Thrombospondin-1

SCOPe Domain Sequences for d2ouhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouhb_ b.29.1.4 (B:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgfl
llaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveealla
tgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnfq
gvlqnvrfvfgttpedilrnkgc

SCOPe Domain Coordinates for d2ouhb_:

Click to download the PDB-style file with coordinates for d2ouhb_.
(The format of our PDB-style files is described here.)

Timeline for d2ouhb_: