| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
| Protein Thrombospondin 1 N-terminal domain [141150] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries) Uniprot P07996 28-233! Uniprot P07996 29-233 |
| Domain d2ouhb_: 2ouh B: [149023] automated match to d1za4a1 complexed with so4 |
PDB Entry: 2ouh (more details), 2.4 Å
SCOPe Domain Sequences for d2ouhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ouhb_ b.29.1.4 (B:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgfl
llaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveealla
tgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnfq
gvlqnvrfvfgttpedilrnkgc
Timeline for d2ouhb_: