![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
![]() | Protein Thrombospondin 1 N-terminal domain [141150] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries) Uniprot P07996 28-233! Uniprot P07996 29-233 |
![]() | Domain d2ouha_: 2ouh A: [149022] automated match to d1za4a1 complexed with so4 |
PDB Entry: 2ouh (more details), 2.4 Å
SCOPe Domain Sequences for d2ouha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ouha_ b.29.1.4 (A:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgfl llaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveealla tgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnfq gvlqnvrfvfgttpedilrnkgc
Timeline for d2ouha_: