![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.213: DinB/YfiT-like putative metalloenzymes [109853] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; an unusual topology with a higher contact order |
![]() | Superfamily a.213.1: DinB/YfiT-like putative metalloenzymes [109854] (4 families) ![]() contains metal-binding site on the bundle surface surrounded by loops |
![]() | Family a.213.1.2: DinB-like [140603] (4 proteins) Pfam PF05163 |
![]() | Protein Hypothetical protein DR1065 [158515] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [158516] (1 PDB entry) Uniprot Q9RVG4 2-184 |
![]() | Domain d2ou6a1: 2ou6 A:2-184 [149020] complexed with gol, ni, so4 |
PDB Entry: 2ou6 (more details), 1.8 Å
SCOPe Domain Sequences for d2ou6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ou6a1 a.213.1.2 (A:2-184) Hypothetical protein DR1065 {Deinococcus radiodurans [TaxId: 1299]} ptfnpelhaqtlnserayfvqpdadpaftphigalvemltyarlttlqaveglpedqlwa tapgfansigtllahiaavervyhvlsfqgrdvtpeddgaaywgltmgkegtaparlptl delraeladaraetlrvfaakddawlaeplgpgwanqhwawfhvmedevnhrgqlrllrq vla
Timeline for d2ou6a1: