Class a: All alpha proteins [46456] (286 folds) |
Fold a.287: TerB-like [158681] (1 superfamily) multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry |
Superfamily a.287.1: TerB-like [158682] (2 families) members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure |
Family a.287.1.1: COG3793-like [158683] (1 protein) Pfam PF07049; DUF1332 |
Protein Tellurite resistance protein of COG3793 [158684] (1 species) |
Species Nostoc punctiforme pcc 73102 [TaxId:63737] [158685] (1 PDB entry) |
Domain d2ou3b_: 2ou3 B: [149019] automated match to d2ou3a1 complexed with cl, edo, i3a, zn |
PDB Entry: 2ou3 (more details), 1.85 Å
SCOPe Domain Sequences for d2ou3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ou3b_ a.287.1.1 (B:) Tellurite resistance protein of COG3793 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} msdikklgsswiinwffgfnqiptnedssiymksvltcakadgvispeekdwalgfcasw gvadwviedlktyeadealeeviarspqvsmaqrdillsaiwvsaadgelhekekakirk matilgikeeivdqleqlyyyeaalrqkrlnllypqkspy
Timeline for d2ou3b_: